Pseudomonas Genome Database - Annotation for PA4757
               gene PA4757                
Add this annotation to your clipboard
Key to gene image


View in GBrowse: (?)
29 putative orthologs Acknowledgements for this annotation
Feature Overview
Strain Pseudomonas aeruginosa PAO1 (Tax ID: 208964) Replicon Pseudomonas aeruginosa PAO1 chromosome, complete genome.
(5681 genes, 6264404 bp) [ RefSeq ]
Feature type gene  Genomic location 5343105 - 5343755 (- strand)
Name   Alternate Names yeaS
Locus tag PA4757 (View 8 updates) Submit an Update Tranposon Mutant Available? 1 mutant(s) available.
Product Information
Feature type CDS
Product Name conserved hypothetical protein
Product Name Confidence Class 4: Homologs of previously reported genes of unknown function, or no similarity to any previously reported sequences.
Alternate Names
Charge at pH 7 (Predicted):9.19
Kyte-Doolittle Hydropathy Score (Predicted):0.875
Molecular Weight (Predicted):23.2 kDa
Isoelectric Point (Predicted):10.39
Subcellular localization
CompartmentTypeConfidence LevelExplanation of Localization Confidence
Cytoplasmic Membrane Primary Class 3: Subcellular localization computationally predicted by PSORTb V3.0.
Orthologs/Comparative Genomics
Pseudomonas Ortholog Group Explanation of Orthologous Groups
Number of Orthologs in Pseudomonas species 29 putative orthologs
OrtholugeDB (New!) Explanation of Orthologous Groups
Secondary Genomic Features contained in PA4757
Name Sequence Start Stop Strand PubMed IDs Cross Reference Other Notes
Confirmed ISphoA/hah insertion site
5343130 5343130 + 14617778
UWGC: 50919
Confirmed ISphoA/hah insertion site
5343365 5343365 + 14617778
UWGC: 51444
Alternate Annotations and Cross-References
GI 15599951
Precomputed BLAST results NCBI BLINK
RefSeq NP_253445
TIGR NTL03PA04758
UniProtKB Acc P38102
UniProtKB ID Y4757_PSEAE
DNASU PaCD00008064
Affymetrix PA4757_at
KEGG PA4757
GBrowse Click GBrowse for a GBrowse View of this and other annotations.
PseudoCyc Click here to view metabolic pathways in PseudoCyc.
Gene Ontology (GO) - Participate in the 2014 Gene Ontology Annotation initiative and get your name on a consortium publication!
Function Classification
PseudoCAP Function Class Membrane proteins
COG PredictionExplanation of COG predictions
Accession Description Category
COG1280 Putative threonine efflux protein Amino acid transport and metabolism
Homology
BLINK Precomputed BLAST results at BLINK
Homologs Explanation of Homologs Field 70% similar to E. coli yeaS hypothetical gene product.
Structure Features
Structure Features Explanation of Structure Features Field 6 predicted transmembrane helices
6 predicted transmembrane helices (TMHMM v.2.0)
At least one transmembrane helix predicted by Phobius
CDD predictions Explanation of CDD predictions
CDD Accession External Accession Database Short Name Description Start Stop E-value Release Number
236807 PRK10958 PRK PRK10958 leucine export protein LeuE; Provisional 1 215 2e-89 3.10
224199 COG1280 COG RhtB Putative threonine efflux protein [Amino acid transport and metabolism] 5 215 6e-33 3.10
216716 pfam01810 Pfam LysE LysE type translocator 17 214 8e-36 3.10
233204 TIGR00949 TIGRFAM 2A76 The Resistance to Homoserine/Threonine (RhtB) Family protein 22 210 9e-52 3.10
 
Microarray Expression Data
NCBI GEO Link
DNA Sequence
Upstream 500 BP Region GACCGTGGTGCCGGCGCAGACACCGGCCAGCGAAGTGCTGGCGCTGAACCCTGACGGCATCTTCCTTTCCAACGGCCCCGGCGACCCCGAACCGTGCGAC
TACGCGATCCAGGCGATCCGCGAATTCCTCGATACCGAGATCCCGGTGTTCGGCATCTGCCTCGGCCATCAGTTGCTGGCCCTGGCCTCTGGCGCCAAGA
CCCTGAAGATGGGCCACGGCCACCACGGCGCCAACCACCCGGTGCAGGACCTGGACAGCGGCGTGGTGATGATCACCAGCCAGAACCACGGTTTCGCGGT
CGACGAGAGCACCCTGCCGGACAACCTGCGAGCCACTCACAAGTCGCTGTTCGACGGTACCCTGCAGGGTATCGAGCGCACCGACAAGGTCGCTTTCAGC
TTCCAGGGCCACCCCGAGGCGAGCCCCGGTCCGCATGACGTCGCCCCGCTGTTCGACCGCTTCATCTCGGCGATGGCCGAGCGTCGCTGAGGAGCAGAGC
C


BLAST search against this genome or other genomes in database
Need more than 500 BP? Try our sequence retrieval tool or view intergenic regions in GBrowse.

DNA Sequence ATGCCGACCCTGGGGATAACCGATTTCTGGACCTACGTGCTGGGTGTGGTTTTCGTGATCCTGTTGCCCGGACCGAACTCGTTGTTCGTCCTCGCGACTT
CGGCCCAGCGTGGCGTGGCGACCGGCTACCGGGCCGCCTGCGGCGTGTTCCTCGGCGACGCGGTGCTGATGCTGCTGTCGGCCCTTGGCGTGGCGTCCCT
GCTGAAGGCCGAGCCGATGCTGTTCATCGGCCTGAAGTACCTCGGTGCGGCCTACCTGTTCTATCTCGGCGTCGGCATGCTGCGGGGCGCCTGGCGCAAG
CTGCGCAATCCCGAAGCGACGGCGGCGCAGGCCGAACAGGTGGATGTCCACCAGCCGTTCCGCAAGGCGCTGCTGCTCAGCCTGTCGAATCCCAAGGCGA
TCCTGTTCTTCATCTCCTTCTTCATCCAGTTCGTCGATCCCGGCTATGCCTATCCGGGGCTGTCGTTCCTGGTGCTGGCGGTGATCCTGGAACTGGTCAG
CGCCCTTTACCTGAGCTTCCTGATTTTCACCGGTGTGCGGCTGGCGGCCTGGTTCCGCCGGCGGCAACGGTTGGCTGCCGGCGCCACTTCGGGCGTCGGC
GCCCTGTTCGTCGGCTTTGGTGTGAAGCTGGCCACCGCAACCCTGTCCTGA


BLAST search against this genome or other genomes in database

Downstream 500 BP region TTATTGCAACGAGAGTCCCATGCCAAAACGTACAGACATAAAGAGCATCCTGATCCTCGGTGCCGGCCCCATCGTGATTGGCCAGGCCTGCGAATTCGAC
TACTCCGGCGCCCAGGCCTGCAAGGCCCTGCGCGAGGAGGGCTACCGCGTCATCCTGGTGAACTCCAACCCCGCGACCATCATGACCGATCCGGCGATGG
CCGACGCGACCTACATCGAGCCGATCAAGTGGGCCACCGTGGCCAAGATCATCGAGAAGGAACGCCCCGACGCGCTGCTGCCGACCATGGGCGGCCAGAC
TGCGTTGAACTGCGCCCTGGACCTGGAGCGCCACGGCGTGCTGGAGAAGTTCGGCGTGGAGATGATCGGCGCCAATGCCGATACCATCGACAAGGCCGAG
GACCGCTCGCGCTTCGACAAGGCGATGAAGGATATCGGCCTGGCCTGTCCGCGCTCGGGCATCGCCCACAGCATGGAGGAGGCCTACGGCGTGCTCGAGC
A


Protein Sequence
Protein Sequence MPTLGITDFWTYVLGVVFVILLPGPNSLFVLATSAQRGVATGYRAACGVFLGDAVLMLLSALGVASLLKAEPMLFIGLKYLGAAYLFYLGVGMLRGAWRK
LRNPEATAAQAEQVDVHQPFRKALLLSLSNPKAILFFISFFIQFVDPGYAYPGLSFLVLAVILELVSALYLSFLIFTGVRLAAWFRRRQRLAAGATSGVG
ALFVGFGVKLATATLS


BLAST search against this genome or other genomes in database
Precomputed BLAST results at BLINK
Operons/Regulons
1) carA-PA4757-carB-greA-PA4754 ( View in GBrowse  )
Genomic Location: From 5338973 to 5344903 bp on - strand
Genes:
PA4754 (PA4754) PA4755 (greA) PA4756 (carB) PA4757 (PA4757) PA4758 (carA)
Estimated Length: 5930 bp (From 5338973 to 5344903 bp)
Evidence:
Class 3: Computationally-predicted.
 [PubMed:18988623]
Cross Reference: DOOR (No external cross-reference is available).  
2) carA-PA4757-carB operon ( View in GBrowse  )
Genomic Location: From 5339864 to 5345023 bp on - strand
Genes:
PA4756 (carB) PA4757 (PA4757) PA4758 (carA)
Estimated Length: 5159 bp (From 5339864 to 5345023 bp)
Evidence:
Class 1: Transcription unit experimentally validated in a strain of the same species. The start coordinate will often be based on an experimentally validated transcription start site. For protein-coding genes, unless otherwise specified, the stop will be based on the stop codon.
 [PubMed:8169201]
Cross Reference: PseudoCAP: 41779
Method lacZ fusion experiment, S1 nuclease mapping
References
PubMed Genome-wide identification of Pseudomonas aeruginosa exported proteins using a consensus computational strategy combined with a laboratory-based PhoA fusion screen.
Lewenza S, Gardy JL, Brinkman FS, Hancock RE.
Genome Res. 2005 Feb;15(2):321-9.
PMID: 15687295